Licensed partner pharmacies

99.2% On-Time Delivery

Tracked international shipping

Tracked International Shipping

Refund within 28 days

Refund Within 28 Days

Secure, encrypted checkout

Secure, Encrypted Checkout

99% Purity garantee

Each peptide batch is tested and verified to meet or exceed 98–99% purity (HPLC).

Storage Handling Notice

Store 2–8 °C (≤–20 °C long-term). RT exposure during transport acceptable. Protect from light.

Licensed partner pharmacies

99.2% On-Time Delivery

Tracked international shipping

Tracked International Shipping

Refund within 28 days

Refund Within 28 Days

Secure, encrypted checkout

Secure, Encrypted Checkout

FOXO4

$267.00

This product is available by prescription only

This product does not require a prescription

Clear Filters

99% Purity garantee

Each peptide batch is tested and verified to meet or exceed 98–99% purity (HPLC).

Storage Handling Notice

Store 2–8 °C (≤–20 °C long-term). RT exposure during transport acceptable. Protect from light.

Product Form

The product is delivered in powdered (lyophilized) form and must be properly reconstituted prior to research use.

FOX04DRI provides a synthetic research peptide formulation developed for scientific applications. Synthetic peptides are manufactured compounds designed through chemical synthesis processes. Each batch undergoes high-purity testing to ensure compound consistency across orders. The formulation is designed for controlled laboratory environments conducting molecular interaction studies. Molecular interaction studies examine how different molecules bind and influence each other. Secure packaging with discreet shipment protects the peptide during transit to research facilities.

Researchers investigate peptide-protein interaction using FOX04DRI in laboratory settings. Peptide-protein interactions examine how peptides bind to larger protein structures. Laboratory teams explore experimental cellular signaling models in controlled research environments. Cellular signaling models are frameworks for studying how cells communicate through molecules. Scientists conduct laboratory-based peptide stability studies under various experimental conditions. Research groups examine how interaction-inhibiting peptides function in controlled systems. These studies occur exclusively in research settings without clinical applications.

FOX04DRI is investigated in research environments for peptide-protein interaction analysis. Scientists have studied this compound within controlled laboratory research models using standardized protocols. The formulation is explored for experimental peptide research in academic and commercial facilities. Researchers evaluate the peptide under controlled conditions without outcome claims.

Store FOX04DRI in cool, dry, light-protected conditions between 2-8°C. Light-protected conditions mean storage away from direct sunlight and intense artificial lighting. This product is intended for laboratory handling only by qualified research personnel. Qualified personnel have received appropriate training in peptide handling and storage procedures. Avoid moisture exposure as water content can affect peptide stability and quality. Avoid heat exposure above recommended temperature ranges to maintain structural integrity. Structural integrity refers to peptides maintaining their proper molecular configuration. Reconstituted solutions should follow established laboratory guidelines specific to peptide research protocols.

Each FOX04DRI batch undergoes comprehensive purity verification procedures through analytical testing. Analytical testing uses scientific instruments to measure peptide composition and quality. Our processes ensure batch-to-batch consistency across all research supply orders. Internal quality assurance standards follow research-grade supply positioning for peptide compounds. Research-grade supply means products meet specifications required for scientific laboratory use. Testing protocols verify peptide purity and structural characteristics using validated methods. Every unit meets our specifications before receiving distribution approval. Laboratory certificates accompany each order for institutional tracking and compliance documentation.

  • CAS: 2460055-10-9
  • Chemical Formula: C₂₂₈H₃₈₈N₈₆O₆₄
  • Molecular Weight: 5358.05 g/mol
  • Peptide Sequence: LTLRKEPASEIAQSILEAYSQNGWANRRSGGKRPPPRRRQRRKKRG
  • Synonyms: FOXO4-DRI
  • Shelf life: 24 months from the manufacturing date.

 

FOX04DRI is a synthetic peptide designed to interact with specific protein targets in research. This compound is manufactured through chemical synthesis to create precise amino acid sequences. Interaction-inhibiting peptides are studied in research to understand molecular binding mechanisms. Molecular binding mechanisms describe how molecules attach to each other at specific sites. Researchers investigate these peptides to examine protein-peptide relationships in laboratory models. The general role of peptides in experimental laboratory models includes serving as molecular probes. Molecular probes help scientists observe and measure biological processes under controlled conditions. Synthetic peptides provide consistent quality across research batches for reproducible experiments. Reproducible experiments can be repeated with similar results using identical materials.

Why Choose Novera Research Peptides?

Novera Research delivers high-quality research peptides developed under strict manufacturing and quality-control standards. Each product is carefully synthesized, tested, and handled to ensure consistency, reliability, and transparency for advanced research applications.

High-purity, research-grade peptide synthesis

Analytical testing to verify quality and composition

Consistent batch-to-batch performance

Batch identification on every vial for traceability

Stored and shipped under controlled conditions

Frequently bought together

Order FOXO4
Reliable Research-Grade FOXO4 Peptide with Verified Laboratory Quality
Buy FOX04DRI peptide exclusively for research applications in qualified laboratories and academic institutions. Our platform provides secure ordering processes for institutional buyers and research coordinators. We offer discreet and reliable delivery to research facilities nationwide. The formulation is available in standardized configurations to support various research requirements. When you order FOX04DRI peptide through our system, complete quality documentation is included. This product cannot be sold for human consumption or veterinary applications. No prescription is required for qualified research institutions to buy FOX04DRI peptide online.

Frequently Asked Questions