Licensed partner pharmacies

99.2% On-Time Delivery

Tracked international shipping

Tracked International Shipping

Refund within 28 days

Refund Within 28 Days

Secure, encrypted checkout

Secure, Encrypted Checkout

99% Purity guarantee

Each peptide batch is tested and verified to meet or exceed 98–99% purity (HPLC).

Storage Handling Notice

Store 2–8 °C (≤–20 °C long-term). RT exposure during transport acceptable. Protect from light.

Licensed partner pharmacies

99.2% On-Time Delivery

Tracked international shipping

Tracked International Shipping

Refund within 28 days

Refund Within 28 Days

Secure, encrypted checkout

Secure, Encrypted Checkout

Cagrilintide (10mg)

$226.00

This product is available by prescription only

This product does not require a prescription

Clear Filters

99% Purity guarantee

Each peptide batch is tested and verified to meet or exceed 98–99% purity (HPLC).

Storage Handling Notice

Store 2–8 °C (≤–20 °C long-term). RT exposure during transport acceptable. Protect from light.

Product Form

The product is delivered in powdered (lyophilized) form and must be properly reconstituted prior to research use.

Long-Acting Amylin Receptor Activation Profile

Cagrilintide is a synthetic long-acting analog of amylin — an endogenous peptide hormone co-secreted with insulin from pancreatic beta cells — engineered with structural modifications that substantially extend receptor engagement duration relative to native amylin in preclinical experimental models. This extended receptor engagement profile supports study designs investigating sustained amylin receptor occupancy dynamics, prolonged downstream intracellular signaling pathway marker activity, and extended central neuroendocrine signaling cascade modulation under defined experimental exposure conditions. The long-acting receptor engagement profile makes Cagrilintide particularly suited to multi-week preclinical protocols examining amylin receptor-mediated pathway marker progression and receptor sensitivity dynamics over extended observation periods.

Mechanistically Distinct Amylin Receptor Pathway Activation

Cagrilintide activates amylin receptors — heterodimeric complexes composed of calcitonin receptor and receptor activity-modifying proteins — engaging downstream signaling cascades mechanistically distinct from GLP-1 receptor or GIP receptor pathway systems. Amylin receptor activation initiates receptor-proximal and downstream intracellular signaling dynamics through mechanisms independent of incretin pathway pharmacology. This mechanistic distinctiveness enables researchers to investigate amylin receptor-specific downstream signaling contributions in isolation from incretin pathway confounds, and to examine complementary amylin and incretin receptor co-activation interaction dynamics in multi-arm comparative study designs.

USA GMP-Certified Supply via Novera

Novera supplies Cagrilintide 10mg sourced from USA GMP-certified manufacturing facilities, independently verified to approximately 99% purity by third-party COA documentation. Each vial confirms peptide sequence identity, purity grade, and batch-specific quality control data — providing research laboratories with consistent, pharmaceutical-grade long-acting amylin analog material for advanced amylin receptor pharmacology and receptor signaling pathway research.

Cagrilintide 10mg is suited for research teams and metabolic signaling laboratories investigating amylin receptor binding kinetics, downstream receptor-mediated pathway marker characterization, and central neuroendocrine signaling cascade dynamics in controlled preclinical models. Scientists examining amylin receptor occupancy parameters, downstream cAMP and MAPK signaling pathway marker activity, and comparative receptor pathway signaling dynamics in pancreatic and hypothalamic preclinical experimental systems will find Cagrilintide relevant to mechanistic amylin receptor pharmacology study designs.

Research programs requiring a structurally defined long-acting amylin analog reference compound for comparative receptor pharmacology investigations alongside GLP-1 receptor agonists or GIP/GLP-1 dual agonists benefit from Cagrilintide’s distinct amylin receptor activation profile — engaging receptor systems and downstream signaling pathway dynamics mechanistically distinct from incretin-based pharmacological tools. Laboratories studying multi-receptor signaling interaction dynamics, complementary amylin and incretin pathway co-activation marker patterns, and next-generation combination receptor pharmacology study designs will find Cagrilintide well-suited to multi-arm comparative receptor pathway research. Novera supplies Cagrilintide 10mg sourced from USA GMP-certified manufacturing facilities, with each vial COA-verified for purity and sequence identity to approximately 99%.

Amylin Receptor Binding Kinetics and Downstream Signaling Cascade Studies

Cagrilintide supports in vitro and preclinical investigation of amylin receptor occupancy dynamics, calcitonin receptor/RAMP heterodimer binding affinity parameters, and downstream cAMP and MAPK signaling cascade activation across pancreatic, hypothalamic, and brainstem area postrema preclinical experimental models. Researchers characterizing amylin receptor occupancy kinetics, downstream PKA pathway marker activity, and central neuroendocrine signaling cascade dynamics following defined long-acting amylin receptor engagement use Cagrilintide as a primary reference compound for mechanistic amylin receptor pharmacology study designs.

Receptor-Linked Peripheral Signaling Pathway Marker Characterization

Laboratories studying amylin receptor-mediated peripheral signaling pathway dynamics use Cagrilintide to quantify downstream pathway marker activity, smooth muscle and epithelial cell signaling endpoint dynamics, and comparative receptor-linked cascade characterization in controlled preclinical model systems. Multi-arm protocols comparing Cagrilintide-mediated receptor-linked marker profiles with GLP-1 receptor-mediated pathway marker dynamics support mechanistic characterization of receptor system-specific contributions to downstream signaling endpoint patterns.

Comparative Pancreatic and Hepatic Signaling Pathway Marker Research

Cagrilintide enables preclinical investigation of amylin receptor-mediated signaling cascade dynamics and downstream pathway marker expression in pancreatic and hepatic preclinical experimental models. Research examining the mechanistic contributions of amylin receptor activation to shared downstream regulatory pathway markers — relative to incretin receptor-mediated pathway dynamics — supports systematic comparative receptor pathway-level dissection of multi-receptor signaling biology.

Complementary Amylin/Incretin Multi-Receptor Interaction and Combination Pharmacology Studies

Cagrilintide’s mechanistically distinct amylin receptor activation profile enables multi-arm study designs examining how amylin receptor co-activation alongside GLP-1 receptor or GIP/GLP-1 dual agonist engagement modifies shared downstream signaling pathway marker patterns in preclinical models. Research quantifying the incremental molecular endpoint contributions of amylin receptor activation to combined amylin/incretin receptor co-activation downstream signaling dynamics contributes to mechanistic characterization of multi-receptor receptor pharmacology interaction biology in controlled preclinical models.

Preparation Guidelines

Reconstitute lyophilized Cagrilintide 10mg with sterile bacteriostatic water using standard sterile laboratory technique. Reconstitution volume should be determined based on the target experimental working concentration specified by the study design. Research protocols should plan preparation timing in accordance with assay scheduling to optimize peptide integrity across all observation phases; document each preparation step in accordance with institutional research record-keeping standards. Use calibrated laboratory equipment throughout all preparation steps.

Storage Conditions

Store lyophilized peptide at 2–8°C, protected from light and moisture, prior to reconstitution. Following reconstitution, maintain refrigeration at 2–8°C; reconstituted peptide stability depends on study conditions and institutional handling standards. This product does not require cold-chain shipping, but immediate refrigeration upon receipt is recommended to preserve long-acting amylin analog peptide integrity throughout the research period. Each vial supplied by Novera includes COA documentation and handling guidance.

Protocol Duration Guidelines

Preclinical amylin receptor pharmacology and receptor signaling pathway studies using Cagrilintide may span variable study durations depending on the receptor pathway dynamics and molecular markers under investigation. Define sampling cadence, assay endpoints, and observation windows in accordance with the study design and institutional laboratory standards. Monitor amylin receptor pathway activity markers, downstream intracellular signaling cascade dynamics, and comparative receptor pathway markers at defined experimental intervals throughout the observation period, in accordance with institutional laboratory standards.

  • CAS: 1415456-99-3
  • Chemical Formula: C₁₉₄H₃₁₂N₅₄O₅₉S₂
  • Molecular Weight: 4409 g/mol
  • Peptide Sequence: XKCNTATCATQRLAEFLRHSSNNFGPILPPTNVGSNTP
  • Synonyms: NN0174-0833, AM833, EX-A10092
  • Shelf life: 24 months from the manufacturing date.

Why Choose Novera Research Peptides?

Novera Research delivers high-quality research peptides developed under strict manufacturing and quality-control standards. Each product is carefully synthesized, tested, and handled to ensure consistency, reliability, and transparency for advanced research applications.

High-purity, research-grade peptide synthesis

Analytical testing to verify quality and composition

Consistent batch-to-batch performance

Batch identification on every vial for traceability

Stored and shipped under controlled conditions

Frequently bought together

Order Cagrilintide (10mg)
Reliable Research-Grade Cagrilintide (10mg) Peptide with Verified Laboratory Quality
Cagrilintide 10mg from Novera provides research teams with a COA-verified, USA GMP-sourced long-acting amylin analog for preclinical amylin receptor pharmacology, receptor-linked signaling pathway marker characterization, and complementary amylin/incretin multi-receptor interaction molecular endpoint studies. Each vial delivers consistently characterized peptide material to approximately 99% purity with full batch documentation. The 10mg vial format supports extended multi-week preclinical protocol designs. Global secure shipping is available for laboratory orders. Every order includes COA documentation, handling instructions, and access to technical support for multi-arm receptor pharmacology and combination receptor signaling experimental protocol design.

Frequently Asked Questions

How does Cagrilintide's receptor activation mechanism differ from GLP-1 receptor agonists in preclinical research models?
What is the mechanistic rationale for studying Cagrilintide in combination with incretin-based compounds in preclinical models?
What preparation and assay scheduling parameters are typically employed in preclinical Cagrilintide research?