Licensed partner pharmacies

99.2% On-Time Delivery

Tracked international shipping

Tracked International Shipping

Refund within 28 days

Refund Within 28 Days

Secure, encrypted checkout

Secure, Encrypted Checkout

99% Purity guarantee

Each peptide batch is tested and verified to meet or exceed 98–99% purity (HPLC).

Storage Handling Notice

Store 2–8 °C (≤–20 °C long-term). RT exposure during transport acceptable. Protect from light.

Licensed partner pharmacies

99.2% On-Time Delivery

Tracked international shipping

Tracked International Shipping

Refund within 28 days

Refund Within 28 Days

Secure, encrypted checkout

Secure, Encrypted Checkout

Cagrilintide (5mg)

$101.00

Coming Soon!

This product is available by prescription only

This product does not require a prescription

Out Of Stock

99% Purity guarantee

Each peptide batch is tested and verified to meet or exceed 98–99% purity (HPLC).

Storage Handling Notice

Store 2–8 °C (≤–20 °C long-term). RT exposure during transport acceptable. Protect from light.

Product Form

The product is delivered in powdered (lyophilized) form and must be properly reconstituted prior to research use.

Cagrilintide provides a research-grade synthetic peptide developed for scientific laboratory applications. Synthetic peptides are manufactured compounds designed to replicate specific amino acid sequences. Each batch undergoes high-purity testing to ensure formulation consistency. The compound is designed for controlled laboratory environments conducting peptide research. Secure packaging with discreet shipment protects the peptide during transit to research facilities across the United States.

Researchers investigate peptide structure and stability using cagrilintide in experimental settings. Laboratory teams explore experimental metabolic pathway models without clinical applications. Metabolic pathway models are research frameworks examining how molecules interact in biological systems. Scientists study controlled laboratory peptide behaviors under various experimental conditions. Research groups examine peptide characteristics using established scientific protocols. These studies occur exclusively in laboratory environments without therapeutic purposes.

Cagrilintide is investigated in research environments for peptide structural analysis. Scientists have studied this compound within experimental laboratory models using controlled protocols. The formulation is explored for peptide-related research applications in academic settings. Researchers evaluate the peptide under controlled conditions without making outcome claims.

Store cagrilintide in cool, dry, light-protected conditions between 2-8°C. Light-protected conditions mean storage away from direct sunlight and intense artificial lighting. This product is intended for laboratory handling only by qualified research personnel. Qualified personnel have received appropriate training in peptide handling and storage procedures. Avoid moisture exposure as humidity can affect peptide stability and quality. Moisture refers to water vapor or liquid water that can contact the peptide. Avoid heat exposure above recommended temperature ranges to maintain structural integrity. Reconstituted solutions should follow established laboratory guidelines for peptide storage and use.

Each cagrilintide batch undergoes purity verification procedures through independent analytical testing. Analytical testing uses scientific instruments to measure peptide quality and composition. Our processes ensure batch-to-batch consistency across all research supply orders. Internal quality assurance standards follow research-grade supply positioning for peptide compounds. Research-grade supply means products meet specifications required for scientific laboratory use. Testing protocols verify peptide purity and structural characteristics before distribution. Every unit meets our specifications before receiving shipment approval. Documentation accompanies each order for institutional quality tracking and compliance purposes.

  • CAS: 1415456-99-3
  • Chemical Formula: C₁₉₄H₃₁₂N₅₄O₅₉S₂
  • Molecular Weight: 4409 g/mol
  • Peptide Sequence: XKCNTATCATQRLAEFLRHSSNNFGPILPPTNVGSNTP
  • Synonyms: NN0174-0833, AM833, EX-A10092
  • Shelf life: 24 months from the manufacturing date.

 

Cagrilintide represents a synthetic peptide developed for laboratory research applications. This compound is created through chemical synthesis to match specific amino acid sequences. Scientists study peptides in metabolic research models to understand molecular interactions at fundamental levels. Metabolic research models examine how peptides behave in systems that process energy and molecules. Peptides play various roles in laboratory research as molecular building blocks and research tools. Molecular building blocks are small units that combine to create larger structures. Researchers investigate synthetic peptides to understand structure-function relationships in controlled settings. The synthetic origin ensures consistent quality across research batches for reproducible experiments.

Why Choose Novera Research Peptides?

Novera Research delivers high-quality research peptides developed under strict manufacturing and quality-control standards. Each product is carefully synthesized, tested, and handled to ensure consistency, reliability, and transparency for advanced research applications.

High-purity, research-grade peptide synthesis

Analytical testing to verify quality and composition

Consistent batch-to-batch performance

Batch identification on every vial for traceability

Stored and shipped under controlled conditions

Frequently bought together

Order Cagrilintide (5mg)
Reliable Research-Grade Cagrilintide (5mg) Peptide with Verified Laboratory Quality
Buy cagrilintide peptide exclusively for research applications in qualified laboratories and academic institutions. Our platform provides secure ordering processes for institutional buyers and research coordinators. Secure ordering means transaction information is protected through encrypted systems. We offer discreet and reliable delivery to research facilities nationwide. The formulation is available in standardized configurations to support various research project requirements. When you order cagrilintide peptide through our system, complete quality documentation is included. This product cannot be sold for human consumption or veterinary applications. No prescription is required for qualified research institutions to order cagrilintide peptide online.

Frequently Asked Questions