Licensed partner pharmacies

99.2% On-Time Delivery

Tracked international shipping

Tracked International Shipping

Refund within 28 days

Refund Within 28 Days

Secure, encrypted checkout

Secure, Encrypted Checkout

99% Purity guarantee

Each peptide batch is tested and verified to meet or exceed 98–99% purity (HPLC).

Storage Handling Notice

Store 2–8 °C (≤–20 °C long-term). RT exposure during transport acceptable. Protect from light.

Licensed partner pharmacies

99.2% On-Time Delivery

Tracked international shipping

Tracked International Shipping

Refund within 28 days

Refund Within 28 Days

Secure, encrypted checkout

Secure, Encrypted Checkout

Cagrilintide 5mg+Semaglutide 5mg

$119.00

This product is available by prescription only

This product does not require a prescription

Clear Filters

99% Purity guarantee

Each peptide batch is tested and verified to meet or exceed 98–99% purity (HPLC).

Storage Handling Notice

Store 2–8 °C (≤–20 °C long-term). RT exposure during transport acceptable. Protect from light.

Product Form

The product is delivered in powdered (lyophilized) form and must be properly reconstituted prior to research use.

This synthetic research peptide formulation provides laboratories with a dual-compound system for experimental studies. The combined 5mg format supports controlled research applications examining multiple peptide mechanisms. Each batch undergoes rigorous purity verification to ensure consistency across research protocols. High-purity formulation meets research-grade standards for dual-peptide investigations. Secure packaging protects compound integrity during storage and transport. Discreet shipment ensures confidential delivery to research facilities and institutional laboratories.

Researchers investigate Cagrilintide and Semaglutide combination within controlled laboratory environments to examine dual-peptide mechanisms. Experimental receptor-binding models utilize this compound system to study combined peptide interactions in vitro. Controlled laboratory peptide stability studies assess compound properties under standardized experimental conditions. Scientists explore dual-mechanism interactions and synergistic pathway characteristics in research settings. Laboratory personnel examine dual-peptide behavior in experimental models designed for combination peptide research. These investigations occur exclusively in controlled research environments without clinical applications.

Cagrilintide and Semaglutide combination is investigated in research environments to understand dual-peptide mechanism interactions. This compound system is studied within controlled laboratory models examining combination peptide properties. Researchers explore this formulation for experimental peptide research applications in academic and institutional settings. Laboratory studies examine the compounds’ combined characteristics under standardized protocols. Scientists investigate structural properties relevant to dual-mechanism research methodologies. All research applications remain confined to laboratory environments and experimental frameworks.

Store the dual-peptide formulation in cool, dry conditions protected from light exposure. Storage temperature should remain consistent to maintain compound stability. Keep the product sealed until ready for laboratory use. Laboratory handling should occur only by qualified research personnel trained in peptide research protocols. Avoid exposure to moisture, heat, and direct sunlight during storage. Use appropriate laboratory equipment when handling this research compound. Reconstitution should follow standard laboratory peptide preparation procedures using sterile techniques. Maintain proper documentation of handling and storage conditions for research records. Dispose of unused material according to institutional laboratory waste protocols.

Each batch undergoes comprehensive purity verification procedures to confirm research-grade quality for both peptide components. Third-party testing validates compound purity at 99%+ by HPLC analysis for each peptide. Batch-to-batch consistency ensures reliable results across research protocols. Certificate of Analysis accompanies each order documenting purity verification results for both compounds. Internal quality assurance standards maintain strict specifications for dual-peptide formulations. Testing procedures verify molecular weight, purity percentage, and compound identity for each component. Research-grade supply positioning ensures suitability for controlled laboratory investigations. Quality control documentation supports institutional research compliance requirements.

  • CAS: Cagrilintide: 1415456-99-3 Semaglutide: 910463-68-2
  • Chemical Formula: Cagrilintide: C₁₉₄H₃₁₂N₅₄₀₅₉₅S₂ Semaglutide: C₁₈₇H₂₉₁N₄₅O₅₉
  • Molecular Weight: Cagrilintide:4409 g/mol Semaglutide: 4114 g/mol
  • Peptide Sequence: Cagrilintide: XKCNTATCATQRLAEFLRHSSNNFGPILPPTNVGSNTP Semaglutide: H-His-Aib-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys(AEEAc-AEEAc-γ-Glu-17-carboxyheptadecanoyl)-Glu-Phe-Ile-Ala-Trp-Leu-Val-Arg-Gly-OH
  • Synonyms: CagriSema
  • Shelf life: 24 months from the manufacturing date.

 

This formulation contains two synthetic peptide compounds produced for research applications. Cagrilintide is a synthetic amylin analog peptide. An amylin analog is a modified version of the amylin peptide hormone. Semaglutide is a synthetic GLP-1 receptor agonist peptide. A GLP-1 receptor agonist is a molecular structure designed to interact with GLP-1 receptors. Both peptides have specific molecular structures studied in laboratory test systems. This dual-peptide combination allows researchers to investigate how different peptide mechanisms interact in experimental settings. This synthetic peptide origin ensures batch-to-batch consistency for research protocols. The compounds consist of defined amino acid sequences with specific modifications. Researchers examine these peptides’ properties within controlled laboratory conditions without therapeutic context.

Why Choose Novera Research Peptides?

Novera Research delivers high-quality research peptides developed under strict manufacturing and quality-control standards. Each product is carefully synthesized, tested, and handled to ensure consistency, reliability, and transparency for advanced research applications.

High-purity, research-grade peptide synthesis

Analytical testing to verify quality and composition

Consistent batch-to-batch performance

Batch identification on every vial for traceability

Stored and shipped under controlled conditions

Frequently bought together

Order Cagrilintide 5mg+Semaglutide 5mg
Reliable Research-Grade Cagrilintide 5mg+Semaglutide 5mg Peptide with Verified Laboratory Quality
Buy Cagrilintide and Semaglutide online through our secure research supply platform designed for institutional procurement. When you order Cagrilintide and Semaglutide online, the process accommodates laboratory purchasing requirements and documentation needs. Our platform allows researchers to buy Cagrilintide and Semaglutide with confidence in product quality and delivery reliability. Order Cagrilintide and Semaglutide directly for your research facility with discreet and secure shipping. This product is furnished for in-vitro studies only and is not for human consumption. Not approved by regulatory agencies to prevent, treat, or cure any medical condition. Bodily introduction into humans or animals is strictly forbidden by law. The secure ordering process protects institutional information and research project confidentiality. Reliable delivery ensures research compounds arrive intact and ready for laboratory storage.

Frequently Asked Questions

What are typical research applications for this dual-peptide formulation?
How should this dual-peptide formulation be stored?
What quality documentation is provided for both peptide components?