Licensed partner pharmacies

99.2% On-Time Delivery

Tracked international shipping

Tracked International Shipping

Refund within 28 days

Refund Within 28 Days

Secure, encrypted checkout

Secure, Encrypted Checkout

99% Purity guarantee

Each peptide batch is tested and verified to meet or exceed 98–99% purity (HPLC).

Storage Handling Notice

Store 2–8 °C (≤–20 °C long-term). RT exposure during transport acceptable. Protect from light.

Licensed partner pharmacies

99.2% On-Time Delivery

Tracked international shipping

Tracked International Shipping

Refund within 28 days

Refund Within 28 Days

Secure, encrypted checkout

Secure, Encrypted Checkout

PNC-27 (5mg)

$149.00

Coming Soon!

This product is available by prescription only

This product does not require a prescription

Out Of Stock

99% Purity guarantee

Each peptide batch is tested and verified to meet or exceed 98–99% purity (HPLC).

Storage Handling Notice

Store 2–8 °C (≤–20 °C long-term). RT exposure during transport acceptable. Protect from light.

Product Form

The product is delivered in powdered (lyophilized) form and must be properly reconstituted prior to research use.

This synthetic research peptide formulation delivers a standardized compound for experimental peptide studies. The mid-range 10mg quantity format provides laboratories with sufficient material for multiple research protocols. Each batch undergoes rigorous purity verification to maintain consistency across experimental applications. High-purity formulation meets research-grade standards for peptide fragment investigations. Secure packaging preserves compound integrity during transport and storage. Discreet shipment ensures confidential delivery to research facilities and institutional laboratories.

Researchers investigate PE-22-28 peptide within controlled laboratory settings to examine peptide signaling pathway mechanisms. Experimental peptide interaction models utilize this compound to study molecular binding characteristics in vitro. Controlled laboratory peptide stability studies assess compound properties under standardized conditions. Scientists explore structural attributes and fragment behavior in research environments. Laboratory personnel examine peptide fragment interactions in experimental models designed for peptide research. These investigations occur exclusively in controlled research settings without clinical applications.

PE-22-28 peptide is investigated in research environments to understand peptide fragment properties. This compound is studied within controlled laboratory models examining molecular structures. Researchers explore this peptide for experimental peptide research applications in academic institutions. Laboratory studies examine the fragment’s characteristics under standardized protocols. Scientists investigate structural properties relevant to peptide research methodologies. All research applications remain confined to laboratory environments and experimental frameworks.

Store PE-22-28 peptide in cool, dry conditions protected from light exposure. Storage temperature should remain stable to preserve compound integrity. Keep the product sealed until ready for laboratory use. Laboratory handling should occur only by qualified research personnel trained in peptide research protocols. Avoid exposure to moisture, heat, and direct sunlight during storage. Use appropriate laboratory equipment when handling this research compound. Reconstitution should follow standard laboratory peptide preparation procedures using sterile techniques. Maintain proper documentation of handling and storage conditions for research records. Dispose of unused material according to institutional laboratory waste protocols.

Each batch undergoes comprehensive purity verification procedures to confirm research-grade quality. Third-party testing validates compound purity at 99%+ by HPLC analysis. Batch-to-batch consistency ensures reliable results across research protocols. Certificate of Analysis accompanies each order documenting purity verification results. Internal quality assurance standards maintain strict compound specifications. Testing procedures verify molecular weight, purity percentage, and compound identity. Research-grade supply positioning ensures suitability for controlled laboratory investigations. Quality control documentation supports institutional research compliance requirements.

  • CAS: N/A
  • Chemical Formula: C₁₈₈H₂₉₃N₅₃O₄₄S
  • Molecular Weight: 4031.7 g/mol
  • Peptide Sequence: PPLSQETFSDLWKLLKKWKMRRNQFWVKVQRG
  • Synonyms: PNC‑27; p53(12–26)–penetratin/MRP chimera; HDM2‑targeted lytic peptide
  • Shelf life: 24 months from the manufacturing date.

 

PE-22-28 peptide is a synthetic peptide fragment produced for research applications. A peptide fragment is a specific portion of a larger peptide chain. Fragments are smaller sections of amino acid sequences that retain particular structural characteristics. Peptide fragments are studied in laboratory research because they help scientists understand how specific sequences contribute to molecular function. This synthetic peptide origin ensures consistent quality for research protocols. The compound represents a defined amino acid sequence isolated for experimental study. Researchers examine this fragment’s properties within controlled laboratory conditions without therapeutic context.

Why Choose Novera Research Peptides?

Novera Research delivers high-quality research peptides developed under strict manufacturing and quality-control standards. Each product is carefully synthesized, tested, and handled to ensure consistency, reliability, and transparency for advanced research applications.

High-purity, research-grade peptide synthesis

Analytical testing to verify quality and composition

Consistent batch-to-batch performance

Batch identification on every vial for traceability

Stored and shipped under controlled conditions

Frequently bought together

Order PNC-27 (5mg)
Reliable Research-Grade PNC-27 (5mg) Peptide with Verified Laboratory Quality
Buy PE-22-28 peptide online through our secure research supply platform designed for institutional procurement. When you order PE-22-28 peptide online, the process accommodates laboratory purchasing requirements and documentation needs. Our platform allows researchers to buy PE-22-28 peptide with confidence in product quality and delivery reliability. Order PE-22-28 peptide directly for your research facility with discreet and secure shipping. This product is furnished for in-vitro studies only and is not for human consumption. Not approved by regulatory agencies to prevent, treat, or cure any medical condition. Bodily introduction into humans or animals is strictly forbidden by law. The secure ordering process protects institutional information and research project confidentiality. Reliable delivery ensures research compounds arrive intact and ready for laboratory storage.

Frequently Asked Questions

What is PNC-27 and what makes it structurally distinct from other research peptides in this catalogue?
What membrane systems are used to investigate PNC-27 in laboratory research?
Why is phosphatidylserine relevant to PNC-27 membrane interaction research?
What is the role of the p53 transactivation domain sequence within PNC-27?
Is PNC-27 intended for human or veterinary use?